KIF5B antibody - N-terminal region (ARP33903_P050)
Data Sheet
 
Product Number ARP33903_P050
Product Page www.avivasysbio.com/kif5b-antibody-n-terminal-region-arp33903-p050.html
Product Name KIF5B antibody - N-terminal region (ARP33903_P050)
Size 100 ul
Gene Symbol KIF5B
Alias Symbols KNS, KINH, KNS1, UKHC
Protein Size (# AA) 963 amino acids
Molecular Weight 110kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3799
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Kinesin family member 5B
Description This is a rabbit polyclonal antibody against KIF5B. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Target Reference Diefenbach,R.J., et al., (2004) Biochem. Biophys. Res. Commun. 319 (3), 987-992
Description of Target Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
Protein Interactions ZBTB8A; HUWE1; TAX1BP1; VPS52; PRKAR2B; AURKB; STAU1; UBC; TRIM25; EZH2; PSME1; PSMB7; PSMB6; PSMB5; PSMB4; PSMB3; PSMA5; PSMA4; KLC2; SMEK2; RNF20; ELP2; PTPN23; RABGAP1; COPE; AKAP2; COPS5; NUP50; PSMA2; KLC1; EPB41L1; DIAPH1; CAST; ACACA; YWHAE; CFTR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-KIF5B (ARP33903_P050) antibody is Catalog # AAP33903 (Previous Catalog # AAPP04974)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
Complete computational species homology data Anti-KIF5B (ARP33903_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KIF5B.
Swissprot Id P33176
Protein Name Kinesin-1 heavy chain
Publications

Turner, L. S. et al. Autophagy is increased in prostate cancer cells overexpressing acid ceramidase and enhances resistance to C6 ceramide. Prostate Cancer Prostatic Dis. 14, 30-7 (2011). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish 21116286

Protein Accession # NP_004512
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KIF5B.
Nucleotide Accession # NM_004521
Conjugation Options

ARP33903_P050-FITC Conjugated

ARP33903_P050-HRP Conjugated

ARP33903_P050-Biotin Conjugated

Species Reactivity Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 86%
Image 1
Human Liver
Human Liver
Image 2
Human brain
WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Image 3
Human MCF7 Whole Cell
Host: Rabbit
Target Name: KIF5B
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com