Product Number |
ARP33856_P050 |
Product Page |
www.avivasysbio.com/acadl-antibody-middle-region-arp33856-p050.html |
Name |
ACADL Antibody - middle region (ARP33856_P050) |
Protein Size (# AA) |
430 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
33 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Acyl-CoA dehydrogenase, long chain |
Alias Symbols |
LCAD, ACAD4 |
Peptide Sequence |
Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000) |
Description of Target |
ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia. |
Protein Interactions |
Htt; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ACADL (ARP33856_P050) antibody |
Blocking Peptide |
For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ACADL |
Uniprot ID |
P28330 |
Protein Name |
Long-chain specific acyl-CoA dehydrogenase, mitochondrial |
Publications |
Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). 22038829 |
Protein Accession # |
NP_001599 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001608 |
Tested Species Reactivity |
Human |
Gene Symbol |
ACADL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Image 1 | Human Placenta
| WB Suggested Anti-ACADL Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta |
|
Image 2 | Human Placenta, Human brain
| Host: Rabbit Target: ACADL Positive control (+): Human Placenta (PL) Negative control (-): Human brain (BR) Antibody concentration: 1ug/ml |
|