ACADL Antibody - middle region (ARP33856_P050)

Data Sheet
 
Product Number ARP33856_P050
Product Page www.avivasysbio.com/acadl-antibody-middle-region-arp33856-p050.html
Name ACADL Antibody - middle region (ARP33856_P050)
Protein Size (# AA) 430 amino acids
Molecular Weight 44kDa
NCBI Gene Id 33
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Acyl-CoA dehydrogenase, long chain
Alias Symbols LCAD, ACAD4
Peptide Sequence Synthetic peptide located within the following region: LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lea,W., Biochim. Biophys. Acta 1485 (2-3), 121-128 (2000)
Description of Target ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Protein Interactions Htt; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACADL (ARP33856_P050) antibody
Blocking Peptide For anti-ACADL (ARP33856_P050) antibody is Catalog # AAP33856 (Previous Catalog # AAPP04927)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACADL
Uniprot ID P28330
Protein Name Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Publications

Mells, J. E. et al. Glp-1 analog, liraglutide, ameliorates hepatic steatosis and cardiac hypertrophy in C57BL/6J mice fed a Western diet. Am. J. Physiol. Gastrointest. Liver Physiol. 302, G225-35 (2012). 22038829

Protein Accession # NP_001599
Purification Affinity Purified
Nucleotide Accession # NM_001608
Tested Species Reactivity Human
Gene Symbol ACADL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Placenta
WB Suggested Anti-ACADL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Image 2
Human Placenta, Human brain
Host: Rabbit
Target: ACADL
Positive control (+): Human Placenta (PL)
Negative control (-): Human brain (BR)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com