Product Number |
ARP33831_P050-FITC |
Product Page |
www.avivasysbio.com/cd40lg-antibody-middle-region-fitc-arp33831-p050-fitc.html |
Name |
CD40LG Antibody - middle region : FITC (ARP33831_P050-FITC) |
Protein Size (# AA) |
261 amino acids |
Molecular Weight |
29kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
959 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CD40 ligand |
Alias Symbols |
IGM, IMD3, TRAP, gp39, CD154, CD40L, HIGM1, T-BAM, TNFSF5, hCD40L |
Peptide Sequence |
Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Huang,F.Y., (er) J. Clin. Immunol. (2008) In press |
Description of Target |
CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830 |
Protein Interactions |
UBC; TRAF2; TRAF1; CD40; BIRC3; BIRC2; CRYAB; IGHG1; CD5L; CD40LG; TP53; IGKC; RNF128; HPR; APOA1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-CD40LG (ARP33831_P050-FITC) antibody |
Blocking Peptide |
For anti-CD40LG (ARP33831_P050-FITC) antibody is Catalog # AAP33831 (Previous Catalog # AAPP04902) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CD40LG |
Uniprot ID |
P29965 |
Protein Name |
CD40 ligand |
Protein Accession # |
NP_000065 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000074 |
Gene Symbol |
CD40LG |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 92%; Rat: 85%; Sheep: 100% |
Image 1 | |
|