A1BG Antibody - N-terminal region (ARP33810_P050)

• Product Number: ARP33810_P050
• Name: A1BG Antibody - N-terminal region (ARP33810_P050)
• Protein Size (# AA): 495 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 1
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: alpha-1-B glycoprotein
• Alias Symbols: A1B, ABG, GAB, HYST2477
• Peptide Sequence: Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Udby,L., et al., (2004) Biochemistry 43 (40), 12877-12886
• Description of Target: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
• Protein Interactions: SETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-A1BG (ARP33810_P050) antibody is Catalog # AAP33810 (Previous Catalog # AAPP04876)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Uniprot ID: P04217
• Protein Name: Alpha-1B-glycoprotein
• Publications:

  Abdi, F. et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J. Alzheimers. Dis. 9, 293-348 (2006). 16914840

  Abdul-Rahman, P. S., Lim, B.-K. & Hashim, O. H. Expression of high-abundance proteins in sera of patients with endometrial and cervical cancers: analysis using 2-DE with silver staining and lectin detection methods. Electrophoresis 28, 1989-96 (2007). 17503403

  Kim, Y.-S. et al. Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome. Int. J. Mol. Med. 31, 707-16 (2013). 23338533

  Surin, B. et al. LG3 fragment of endorepellin is a possible biomarker of severity in IgA nephropathy. Proteomics 13, 142-52 (2013). 23161552

  Tian, M. et al. Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. BMC Cancer 8, 241 (2008). 18706098

• Protein Accession #: NP_570602
• Purification: Affinity Purified
• Nucleotide Accession #: NM_130786
• Tested Species Reactivity: Human
• Gene Symbol: A1BG
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Fetal Liver
  
  WB Suggested Anti-A1BG Antibody
  Titration: 0.1ug/ml
  Positive Control: Fetal Liver
• Image 2: Human
  
  WB Suggested Anti-A1BG Antibody
  Titration: 5 ug/ml
  Positive Control: human liver, human serum, human plasma
• Image 3: Human HepG2
  
  WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole CellA1BG is supported by BioGPS gene expression data to be expressed in HepG2
• Image 4: Human HepG2
  
  Host: Rabbit
  Target Name: EGFL8
  Sample Type: HepG2
  Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in HepG2
• Image 5: Human Jurkat
  
  Host: Rabbit
  Target Name: A1BG
  Sample Type: Jurkat
  Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 6: Human 721_B
  
  Host: Rabbit
  Target Name: A1BG
  Sample Type: 721_B
  Antibody Dilution: 1.0ug/mlA1BG s supported by BioGPS gene expression data to be expressed in 721_B