AFM Antibody - C-terminal region (ARP33803_P050)

• Product Number: ARP33803_P050
• Name: AFM Antibody - C-terminal region (ARP33803_P050)
• Protein Size (# AA): 599 amino acids
• Molecular Weight: 67kDa
• NCBI Gene Id: 173
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Afamin
• Alias Symbols: ALF, ALB2, ALBA
• Peptide Sequence: Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AFM (ARP33803_P050) antibody is Catalog # AAP33803 (Previous Catalog # AAPP04869)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AFM
• Uniprot ID: P43652
• Protein Name: Afamin
• Protein Accession #: NP_001124
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001133
• Tested Species Reactivity: Human
• Gene Symbol: AFM
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 91%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 92%
• Image 1: Human HepG2
  
  WB Suggested Anti-AFM Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate