| Product Number |
ARP33798_P050 |
| Product Page |
www.avivasysbio.com/atp7a-antibody-middle-region-arp33798-p050.html |
| Name |
ATP7A Antibody - middle region (ARP33798_P050) |
| Protein Size (# AA) |
1500 amino acids |
| Molecular Weight |
163kDa |
| NCBI Gene Id |
538 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATPase, Cu++ transporting, alpha polypeptide |
| Description |
|
| Alias Symbols |
MK, MNK, DSMAX, SMAX3 |
| Peptide Sequence |
Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,L.P., (2008) Chin. Med. J. 121 (2), 175-177 |
| Description of Target |
The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Gol |
| Protein Interactions |
ACIN1; UBC; COMMD1; CLU; ATOX1; PDZD11; CP; GLRX; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ATP7A (ARP33798_P050) antibody |
| Specificity |
This antibody is will react to isoforms 1-5. |
| Blocking Peptide |
For anti-ATP7A (ARP33798_P050) antibody is Catalog # AAP33798 (Previous Catalog # AAPS07703) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ATP7A |
| Uniprot ID |
Q04656 |
| Protein Name |
Copper-transporting ATPase 1 |
| Publications |
Impaired copper transport in schizophrenia results in a copper-deficient brain state: A new side to the dysbindin story. World J Biol Psychiatry. 21, 13-28 (2020). 30230404 |
| Sample Type Confirmation |
ATP7A is supported by BioGPS gene expression data to be expressed in HT1080 |
| Protein Accession # |
NP_000043 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000052 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ATP7A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HT1080
 | WB Suggested Anti-ATP7A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysateATP7A is supported by BioGPS gene expression data to be expressed in HT1080 |
|
| Image 2 | Mouse, Human
 | Lanes:
Lane1: 40 ug mouse endothelial firboblast lysate
Lane2: 40 ug human HUVEC lysate
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
ATP7A
Submitted by:
Anonymous
|
|
