Product Number |
ARP33797_T100-HRP |
Product Page |
www.avivasysbio.com/atp7a-antibody-n-terminal-region-hrp-arp33797-t100-hrp.html |
Name |
ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP) |
Protein Size (# AA) |
1500aa amino acids |
Molecular Weight |
163kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
538 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ATPase, Cu++ transporting, alpha polypeptide |
Alias Symbols |
MK, MNK, DSMAX, SMAX3 |
Peptide Sequence |
Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
Ueta,A., Unpublished |
Description of Target |
The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene. |
Protein Interactions |
ACIN1; UBC; COMMD1; CLU; ATOX1; PDZD11; CP; GLRX; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ATP7A (ARP33797_T100-HRP) antibody |
Specificity |
The immunizing peptide used to raise this antibody is 100% homologous to isoform 3 (503aa 54.3kDa), 1 (1514aa, 165kDa), 2 (1581aa, 172kDa) and 5 (1422aa, 154kDa) of human ATP7A. |
Blocking Peptide |
For anti-ATP7A (ARP33797_T100-HRP) antibody is Catalog # AAP33797 (Previous Catalog # AAPP04863) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A |
Uniprot ID |
Q04656 |
Protein Name |
ATP7A protein EMBL BAC82353.1 |
Protein Accession # |
NP_000043 |
Nucleotide Accession # |
NM_000052.5 |
Gene Symbol |
ATP7A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100% |
Image 1 | |
|