| Product Number |
ARP33797_T100 |
| Product Page |
www.avivasysbio.com/atp7a-antibody-n-terminal-region-arp33797-t100.html |
| Name |
ATP7A Antibody - N-terminal region (ARP33797_T100) |
| Protein Size (# AA) |
1500aa amino acids |
| Molecular Weight |
163kDa |
| NCBI Gene Id |
538 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
ATPase, Cu++ transporting, alpha polypeptide |
| Description |
|
| Alias Symbols |
MK, MNK, DSMAX, SMAX3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ueta,A., Unpublished |
| Description of Target |
The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene. |
| Protein Interactions |
ACIN1; UBC; COMMD1; CLU; ATOX1; PDZD11; CP; GLRX; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ATP7A (ARP33797_T100) antibody |
| Specificity |
The immunizing peptide used to raise this antibody is 100% homologous to isoform 3 (503aa 54.3kDa), 1 (1514aa, 165kDa), 2 (1581aa, 172kDa) and 5 (1422aa, 154kDa) of human ATP7A. |
| Blocking Peptide |
For anti-ATP7A (ARP33797_T100) antibody is Catalog # AAP33797 (Previous Catalog # AAPP04863) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A |
| Uniprot ID |
Q04656 |
| Protein Name |
ATP7A protein EMBL BAC82353.1 |
| Publications |
Cytotoxic phenanthroline derivatives alter metallostasis and redox homeostasis in neuroblastoma cells. Oncotarget. 9, 36289-36316 (2018). 30555630 |
| Protein Accession # |
NP_000043 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000052.5 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ATP7A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100% |
| Image 1 | Human Ovary Tumor
 | Host: Rabbit
Target Name: ATP7A
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml |
|
