CRSP9 Antibody - N-terminal region (ARP33741_P050)

• Product Number: ARP33741_P050
• Name: CRSP9 Antibody - N-terminal region (ARP33741_P050)
• Protein Size (# AA): 233 amino acids
• Molecular Weight: 27kDa
• Subunit: 7
• NCBI Gene Id: 9443
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mediator complex subunit 7
• Alias Symbols: ARC34, CRSP9, CRSP33
• Peptide Sequence: Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ryu,S., et al., (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (13), 7137-7142
• Description of Target: CRSP9 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. CRSP9 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated p
• Protein Interactions: HAUS1; CDK8; CDK19; MED13; MED19; MED26; EPAS1; MED6; UBE2I; UL48; SUMO2; UBC; CTDP1; MED10; MED25; MED15; MED14; VDR; SREBF1; RELA; PARP1; ZSCAN1; TRIM15; RHOXF2; PCBD2; MED31; TRIM29; RBFOX2; IKBKG; LZTR1; PML; MED9; MED8; HGS; MED1; HNF4A; ESR2; ESR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MED7 (ARP33741_P050) antibody is Catalog # AAP33741 (Previous Catalog # AAPP05138)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP9
• Uniprot ID: O43513
• Protein Name: Mediator of RNA polymerase II transcription subunit 7
• Sample Type Confirmation:

  MED7 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_004261
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004270
• Tested Species Reactivity: Human
• Gene Symbol: MED7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Adult Liver
  
  Rabbit Anti-CRSP9 Antibody
  Catalog Number: ARP33741_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Nuclear (strong) in hepatocytes, strong signal, wide tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 2: Human 293T
  
  WB Suggested Anti-CRSP9 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysateMED7 is supported by BioGPS gene expression data to be expressed in HEK293T
• Image 3: Human Pineal Tissue
  
  CRSP9 antibody - N-terminal region (ARP33741_P050)
  Catalog Number: ARP33741_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasm and nuclear membrane in Human Pineal Tissue
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec