| Product Number |
ARP33647_P050-Biotin |
| Product Page |
www.avivasysbio.com/ap3b1-antibody-n-terminal-region-biotin-arp33647-p050-biotin.html |
| Name |
Ap3b1 Antibody - N-terminal region : Biotin (ARP33647_P050-Biotin) |
| Protein Size (# AA) |
1096 amino acids |
| Molecular Weight |
121kDa |
| Subunit |
beta-1 |
| Conjugation |
Biotin |
| NCBI Gene Id |
309969 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Adaptor-related protein complex 3, beta 1 subunit |
| Alias Symbols |
Ap3b1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The function of Ap3b1 remains unknown. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-Ap3b1 (ARP33647_P050-Biotin) antibody |
| Blocking Peptide |
For anti-Ap3b1 (ARP33647_P050-Biotin) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D4AA25 |
| Protein Name |
Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1 |
| Protein Accession # |
EDM10075 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001107646 |
| Gene Symbol |
Ap3b1 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93% |
| Image 1 | |
|
