CLDN1 Antibody - C-terminal region (ARP33623_P050)

Data Sheet
 
Product Number ARP33623_P050
Product Page www.avivasysbio.com/cldn1-antibody-c-terminal-region-arp33623-p050.html
Name CLDN1 Antibody - C-terminal region (ARP33623_P050)
Protein Size (# AA) 211 amino acids
Molecular Weight 23 kDa
NCBI Gene Id 9076
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Claudin 1
Description
Alias Symbols CLD1, SEMP1, ILVASC
Peptide Sequence Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Coyne,C.B., et al., (2003) Am. J. Physiol. Lung Cell Mol. Physiol. 285 (5), L1166-L1178
Description of Target Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Protein Interactions UBC; DRG1; LNX1; TJP3; BRD4; MPDZ; TJP2; CLDN1; INADL; CLDN3; WNK4; TJP1; MMP14; MMP2; CLDN5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-CLDN1 (ARP33623_P050) antibody
Blocking Peptide For anti-CLDN1 (ARP33623_P050) antibody is Catalog # AAP33623 (Previous Catalog # AAPP04679)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1
Uniprot ID O95832
Protein Name Claudin-1
Protein Accession # NP_066924
Purification Affinity Purified
Nucleotide Accession # NM_021101
Tested Species Reactivity Human
Gene Symbol CLDN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Image 1
Human Liver
Human Liver
Image 2
Human MCF7 Whole Cell
Host: Rabbit
Target Name: CLDN1
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 3ug/ml
Image 3
Human MCF7 Whole Cell
Host: Rabbit
Target Name: CLDN1
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 3ug/ml
Image 4
Human Hela Whole Cell
Host: Rabbit
Target Name: CLDN1
Sample Tissue: Human Hela Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com