| Product Number |
ARP33617_T100 |
| Product Page |
www.avivasysbio.com/cldn9-antibody-c-terminal-region-arp33617-t100.html |
| Name |
CLDN9 Antibody - C-terminal region (ARP33617_T100) |
| Protein Size (# AA) |
217 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
9080 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Claudin 9 |
| Alias Symbols |
DFNB116 |
| Peptide Sequence |
Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689 |
| Description of Target |
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLDN9 (ARP33617_T100) antibody |
| Blocking Peptide |
For anti-CLDN9 (ARP33617_T100) antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN9 |
| Uniprot ID |
O95484 |
| Protein Name |
Claudin-9 |
| Publications |
Abuazza, G. et al. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am. J. Physiol. Renal Physiol. 291, F1132-41 (2006). 16774906
Carrozzino, F., Pugnale, P., Féraille, E. & Montesano, R. Inhibition of basal p38 or JNK activity enhances epithelial barrier function through differential modulation of claudin expression. Am. J. Physiol. Cell Physiol. 297, C775-87 (2009). 19605737 |
| Protein Accession # |
NP_066192 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020982 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLDN9 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CLDN9 Antibody Titration: 2.0ug/ml
Positive Control: HepG2 cell lysate |
|
|
