| Product Number |
ARP33600_P050 |
| Product Page |
www.avivasysbio.com/cbll1-antibody-c-terminal-region-arp33600-p050.html |
| Name |
Cbll1 Antibody - C-terminal region (ARP33600_P050) |
| Protein Size (# AA) |
490 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
104836 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Casitas B-lineage lymphoma-like 1 |
| Alias Symbols |
Ha, Hakai, c-Cbl-l, AI467391, c-Cbl-like |
| Peptide Sequence |
Synthetic peptide located within the following region: PPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Cbll1 promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation. |
| Protein Interactions |
CBLL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cbll1 (ARP33600_P050) antibody |
| Blocking Peptide |
For anti-Cbll1 (ARP33600_P050) antibody is Catalog # AAP33600 (Previous Catalog # AAPP04656) |
| Uniprot ID |
Q9JIY2 |
| Protein Name |
E3 ubiquitin-protein ligase Hakai |
| Protein Accession # |
NP_598809 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_134048 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Cbll1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Cbll1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney |
|
|
