| Product Number |
ARP33556_P050 |
| Product Page |
www.avivasysbio.com/znf236-antibody-middle-region-arp33556-p050.html |
| Name |
ZNF236 Antibody - middle region (ARP33556_P050) |
| Protein Size (# AA) |
1845 amino acids |
| Molecular Weight |
204kDa |
| NCBI Gene Id |
7776 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 236 |
| Alias Symbols |
ZNF236A, ZNF236B |
| Peptide Sequence |
Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Halama,N., (2003) Genomics 82 (3), 406-411 |
| Description of Target |
ZNF236 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 30 C2H2-type zinc fingers. ZNF236 may be involved in transcriptional regulation. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF236 (ARP33556_P050) antibody |
| Blocking Peptide |
For anti-ZNF236 (ARP33556_P050) antibody is Catalog # AAP33556 (Previous Catalog # AAPP04611) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF236 |
| Uniprot ID |
Q9UL36 |
| Protein Name |
Zinc finger protein 236 |
| Sample Type Confirmation |
ZNF236 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_031371 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007345 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF236 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF236 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateZNF236 is supported by BioGPS gene expression data to be expressed in HepG2 |
| | Image 2 | Human Adult Liver
 | Rabbit Anti-ZNF236 Antibody
Catalog Number: ARP33556_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, moderate signal, moderate tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
|
