ZNF24 Antibody - N-terminal region (ARP33518_P050)

Data Sheet
 
Product Number ARP33518_P050
Product Page www.avivasysbio.com/znf24-antibody-n-terminal-region-arp33518-p050.html
Name ZNF24 Antibody - N-terminal region (ARP33518_P050)
Protein Size (# AA) 368 amino acids
Molecular Weight 40kDa
NCBI Gene Id 7572
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name zinc finger protein 24
Alias Symbols KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191
Peptide Sequence Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Description of Target ZNF24 is a transcription factor required for myelination of differentiated oligodendrocytes. It is required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), it is involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). It has transcription repressor activity in vitro.
Protein Interactions DDX6; MID2; FAM115A; DZIP3; ZSCAN21; LMO2; ZNF396; ZNF483; PGBD1; ZNF446; ZSCAN32; SEC62; HMGB1; APLP1; PPP1CC; ERCC8; OR8B2; YY1; PSMA2; MZF1; SUMO1; SUMO2; SMARCAD1; UBC; SOX2; ZNHIT3; TRIM25; KBTBD7; USP11; LRIF1; KIAA1377; COPS6; SCAND1; RBM48; ZBTB16
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF24 (ARP33518_P050) antibody
Blocking Peptide For anti-ZNF24 (ARP33518_P050) antibody is Catalog # AAP33518
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF24
Uniprot ID P17028
Protein Name Zinc finger protein 24
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol ZNF24
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human HepG2 Whole Cell
Host: Rabbit
Target Name: ZNF24
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com