| Product Number |
ARP33506_P050 |
| Product Page |
www.avivasysbio.com/znf3-antibody-n-terminal-region-arp33506-p050.html |
| Name |
ZNF3 Antibody - N-terminal region (ARP33506_P050) |
| Protein Size (# AA) |
410 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
7551 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 3 |
| Alias Symbols |
A8-51, HF.12, KOX25, PP838, Zfp113 |
| Peptide Sequence |
Synthetic peptide located within the following region: METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQEL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF3 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF3 is involved in cell differentiation and/or proliferation. |
| Protein Interactions |
SSX2IP; MTUS2; TRAF4; BAG3; ZNF212; ZNF3; ID3; FHL2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF3 (ARP33506_P050) antibody |
| Blocking Peptide |
For anti-ZNF3 (ARP33506_P050) antibody is Catalog # AAP33506 (Previous Catalog # AAPP04557) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF3 |
| Uniprot ID |
P17036 |
| Protein Name |
Zinc finger protein 3 |
| Protein Accession # |
AAP35564 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
Q86U76 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Goat: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-ZNF3 Antibody
Catalog Number: ARP33506_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, moderate signal, low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
| | Image 2 | Human Muscle
 | WB Suggested Anti-ZNF3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
