Product Number |
ARP33381_T100 |
Product Page |
www.avivasysbio.com/zfp36l1-antibody-n-terminal-region-arp33381-t100.html |
Name |
ZFP36L1 Antibody - N-terminal region (ARP33381_T100) |
Protein Size (# AA) |
338 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
677 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 36, C3H type-like 1 |
Alias Symbols |
BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B |
Peptide Sequence |
Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rual,J.F., (2005) Nature 437 (7062), 1173-1178 |
Description of Target |
ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. |
Protein Interactions |
MAPK14; MAPKAPK2; YWHAB; UBC; AKT1; RBM8A; ACD; TINF2; POT1; TERF1; ELAVL1; PAFAH1B2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZFP36L1 (ARP33381_T100) antibody |
Blocking Peptide |
For anti-ZFP36L1 (ARP33381_T100) antibody is Catalog # AAP33381 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1 |
Uniprot ID |
Q07352 |
Protein Name |
Zinc finger protein 36, C3H1 type-like 1 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat |
Protein Accession # |
NP_004917 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004926 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZFP36L1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | MCF7, 293T
| Host: Rabbit Target: ZFP36L1 Positive control (+): MCF7 (N10) Negative control (-): 293T (2T) Antibody concentration: 1ug/ml |
|
Image 2 | Human 293T
| Host: Rabbit Target Name: ZFP36L1 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human HepG2 Whole Cell
| Host: Rabbit Target Name: ZFP36L1 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml |
|