ZFP36L1 Antibody - N-terminal region (ARP33381_T100)

Data Sheet
 
Product Number ARP33381_T100
Product Page www.avivasysbio.com/zfp36l1-antibody-n-terminal-region-arp33381-t100.html
Name ZFP36L1 Antibody - N-terminal region (ARP33381_T100)
Protein Size (# AA) 338 amino acids
Molecular Weight 36kDa
NCBI Gene Id 677
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 36, C3H type-like 1
Alias Symbols BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B
Peptide Sequence Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Description of Target ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Protein Interactions MAPK14; MAPKAPK2; YWHAB; UBC; AKT1; RBM8A; ACD; TINF2; POT1; TERF1; ELAVL1; PAFAH1B2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFP36L1 (ARP33381_T100) antibody
Blocking Peptide For anti-ZFP36L1 (ARP33381_T100) antibody is Catalog # AAP33381
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1
Uniprot ID Q07352
Protein Name Zinc finger protein 36, C3H1 type-like 1
Sample Type Confirmation

There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat

Protein Accession # NP_004917
Purification Protein A purified
Nucleotide Accession # NM_004926
Tested Species Reactivity Human
Gene Symbol ZFP36L1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
MCF7, 293T
Host: Rabbit
Target: ZFP36L1
Positive control (+): MCF7 (N10)
Negative control (-): 293T (2T)
Antibody concentration: 1ug/ml
Image 2
Human 293T
Host: Rabbit
Target Name: ZFP36L1
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 3
Human HepG2 Whole Cell
Host: Rabbit
Target Name: ZFP36L1
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com