SOX5 Antibody - C-terminal region (ARP33323_P050)

Data Sheet
 
Product Number ARP33323_P050
Product Page www.avivasysbio.com/sox5-antibody-c-terminal-region-arp33323-p050.html
Name SOX5 Antibody - C-terminal region (ARP33323_P050)
Protein Size (# AA) 763 amino acids
Molecular Weight 84 kDa
NCBI Gene Id 6660
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SRY (sex determining region Y)-box 5
Description
Alias Symbols L-SOX5, LAMSHF, L-SOX5B, L-SOX5F
Peptide Sequence Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
Protein Interactions SUMO1P1; MORN3; PRR20A; FAM46B; CBX8; ZNF581; ARID5A; KAT5; CDC23; TAF6; SOX5; LMO2; LMO1; KIFC3; CRX; AES; MED27; UQCRFS1; TTC1; RPS2; SMAD7; SMAD5; SMAD1; FTH1; CDK6; CDC25A; APP; SOX2; SOX6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SOX5 (ARP33323_P050) antibody
Specificity Designed to recognize all five isoforms of human SOX5 (84, 82, 42, 71 and 83kDa)
Blocking Peptide For anti-SOX5 (ARP33323_P050) antibody is Catalog # AAP33323 (Previous Catalog # AAPP04365)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
Uniprot ID P35711
Protein Name SRY (Sex determining region Y)-box 5 isoform c variant EMBL BAD97256.1
Publications

Aza-Carmona, M. et al. SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer. Hum. Mol. Genet. 20, 1547-59 (2011). 21262861

Boije, H. et al. Sonic Hedgehog-signalling patterns the developing chicken comb as revealed by exploration of the pea-comb mutation. PLoS One 7, e50890 (2012). 23227218

Fernandes, A. M. et al. Similar properties of chondrocytes from osteoarthritis joints and mesenchymal stem cells from healthy donors for tissue engineering of articular cartilage. PLoS One 8, e62994 (2013). 23671648

Kiselak, E. A. et al. Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5. J. Biol. Chem. 285, 30496-505 (2010). 20668334

Martelli, M. L. et al. Exploiting orthologue diversity for systematic detection of gain-of-function phenotypes. BMC Genomics 9, 254 (2008). 18510758

Naveau, E. et al. Alteration of rat fetal cerebral cortex development after prenatal exposure to polychlorinated biphenyls. PLoS One 9, e91903 (2014). 24642964

Pytel, P. et al. Neoplasms with schwannian differentiation express transcription factors known to regulate normal schwann cell development. Int. J. Surg. Pathol. 18, 449-57 (2010). 20034979

Tchougounova, E. et al. Sox5 can suppress platelet-derived growth factor B-induced glioma development in Ink4a-deficient mice through induction of acute cellular senescence. Oncogene 28, 1537-48 (2009). 19219070

Torii, M., Hashimoto-Torii, K., Levitt, P. & Rakic, P. Integration of neuronal clones in the radial cortical columns by EphA and ephrin-A signalling. Nature 461, 524-8 (2009). 19759535

Transcriptional regulation of human sperm-associated antigen 16 gene by S-SOX5. BMC Mol. Biol. 18, 2 (2017). 28137312

Wright, D. et al. Copy number variation in intron 1 of SOX5 causes the Pea-comb phenotype in chickens. PLoS Genet. 5, e1000512 (2009). 19521496

Yu, J. et al. Array-based comparative genomic hybridization identifies CDK4 and FOXM1 alterations as independent predictors of survival in malignant peripheral nerve sheath tumor. Clin. Cancer Res. 17, 1924-34 (2011). 21325289

Protein Accession # NP_821078
Purification Affinity Purified
Nucleotide Accession # NM_178010
Tested Species Reactivity Human, Mouse
Gene Symbol SOX5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Image 1
THP-1, A549
Host: Rabbit
Target: SOX5
Positive control (+): THP-1 (N30)
Negative control (-): A549 (N03)
Antibody concentration: 1ug/ml
Image 2
Human MCF7
Host: Rabbit
Target Name: SOX5
Sample Tissue: Human MCF7
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com