MRPS15 Antibody - N-terminal region (ARP33299_P050)

• Product Number: ARP33299_P050
• Name: MRPS15 Antibody - N-terminal region (ARP33299_P050)
• Protein Size (# AA): 257 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 64960
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitochondrial ribosomal protein S15
• Alias Symbols: DC37, S15mt, RPMS15, MPR-S15
• Peptide Sequence: Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480
• Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
• Protein Interactions: GRSF1; UBC; PARK2; ESR2; PTCD3; CAND1; COPS5; CUL3; SUMO2; ICT1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MRPS15 (ARP33299_P050) antibody is Catalog # AAP33299 (Previous Catalog # AAPP04341)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS15
• Uniprot ID: P82914
• Protein Name: 28S ribosomal protein S15, mitochondrial
• Publications:

  Davies, S. M. K. et al. Pentatricopeptide repeat domain protein 3 associates with the mitochondrial small ribosomal subunit and regulates translation. FEBS Lett. 583, 1853-8 (2009). 19427859

• Sample Type Confirmation:

  MRPS15 is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_112570
• Purification: Affinity Purified
• Nucleotide Accession #: NM_031280
• Tested Species Reactivity: Human
• Gene Symbol: MRPS15
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 83%; Rabbit: 86%; Rat: 92%
• Image 1: Human 721_B
  
  WB Suggested Anti-MRPS15 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: 721_B cell lysateMRPS15 is supported by BioGPS gene expression data to be expressed in 721_B
• Image 2: Human Lung
  
  Human Lung
• Image 3: Human Bronchial Epithelial Tissue
  
  Rabbit Anti-MRPS15 Antibody
  Catalog Number: ARP33299_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Plasma Membrane
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec