Product Number |
ARP33297_P050-HRP |
Product Page |
www.avivasysbio.com/sim2-antibody-middle-region-hrp-arp33297-p050-hrp.html |
Name |
SIM2 Antibody - middle region : HRP (ARP33297_P050-HRP) |
Protein Size (# AA) |
667 amino acids |
Molecular Weight |
73kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
6493 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
single-minded homolog 2 (Drosophila) |
Alias Symbols |
SIM, bHLHe15, HMC13F06, HMC29C01 |
Peptide Sequence |
Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
N/A |
Description of Target |
This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-SIM2 (ARP33297_P050-HRP) antibody |
Blocking Peptide |
For anti-SIM2 (ARP33297_P050-HRP) antibody is Catalog # AAP33297 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SIM2 |
Uniprot ID |
Q14190 |
Protein Name |
Single-minded homolog 2 |
Purification |
Affinity purified |
Gene Symbol |
SIM2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100% |
Image 1 | |
|