SIM2 Antibody - middle region : HRP (ARP33297_P050-HRP)

Data Sheet
 
Product Number ARP33297_P050-HRP
Product Page www.avivasysbio.com/sim2-antibody-middle-region-hrp-arp33297-p050-hrp.html
Name SIM2 Antibody - middle region : HRP (ARP33297_P050-HRP)
Protein Size (# AA) 667 amino acids
Molecular Weight 73kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 6493
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name single-minded homolog 2 (Drosophila)
Alias Symbols SIM, bHLHe15, HMC13F06, HMC29C01
Peptide Sequence Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference N/A
Description of Target This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SIM2 (ARP33297_P050-HRP) antibody
Blocking Peptide For anti-SIM2 (ARP33297_P050-HRP) antibody is Catalog # AAP33297
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SIM2
Uniprot ID Q14190
Protein Name Single-minded homolog 2
Purification Affinity purified
Gene Symbol SIM2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com