SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)

Data Sheet
 
Product Number ARP33297_P050-FITC
Product Page www.avivasysbio.com/sim2-antibody-middle-region-fitc-arp33297-p050-fitc.html
Product Name SIM2 Antibody - middle region : FITC (ARP33297_P050-FITC)
Size 100 ul
Gene Symbol SIM2
Alias Symbols SIM2, BHLHE15,
Protein Size (# AA) 667 amino acids
Molecular Weight 73kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
NCBI Gene Id 6493
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Official Gene Full Name single-minded homolog 2 (Drosophila)
Peptide Sequence Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK
Target Reference N/A
Description of Target This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-SIM2 (ARP33297_P050-FITC) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SIM2 (ARP33297_P050-FITC) antibody is Catalog # AAP33297
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SIM2
Complete computational species homology data Anti-SIM2 (ARP33297_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SIM2.
Swissprot Id Q14190
Protein Name Single-minded homolog 2
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SIM2.
Replacement Item This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 92%; Rat: 100%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com