| Product Number |
ARP33283_P050 |
| Product Page |
www.avivasysbio.com/bnc1-antibody-c-terminal-region-arp33283-p050.html |
| Name |
Bnc1 Antibody - C-terminal region (ARP33283_P050) |
| Protein Size (# AA) |
990 amino acids |
| Molecular Weight |
110kDa |
| NCBI Gene Id |
12173 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Basonuclin 1 |
| Description |
|
| Alias Symbols |
Bnc, AI047752, AW546376 |
| Peptide Sequence |
Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Bnc1 remains unknown. |
| Protein Interactions |
Pmaip1; Bcl2l11; Bmf; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Bnc1 (ARP33283_P050) antibody |
| Blocking Peptide |
For anti-Bnc1 (ARP33283_P050) antibody is Catalog # AAP33283 (Previous Catalog # AAPP04325) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
O35914 |
| Publications |
Feuerborn, A., Mathow, D., Srivastava, P. K., Gretz, N. & Gröne, H.-J. Basonuclin-1 modulates epithelial plasticity and TGF-beta1-induced loss of epithelial cell integrity. Oncogene. doi:10.1038/onc.2014.54 (2014). 24662832 |
| Protein Accession # |
NP_031588 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007562 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Bnc1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Intestine
 | WB Suggested Anti-Bnc1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Intestine |
|
|
