Rb1 Antibody - middle region (ARP33211_P050)

• Product Number: ARP33211_P050
• Name: Rb1 Antibody - middle region (ARP33211_P050)
• Protein Size (# AA): 921 amino acids
• Molecular Weight: 101kDa
• NCBI Gene Id: 19645
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: retinoblastoma 1
• Alias Symbols: R, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1
• Peptide Sequence: Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: SLC11A1 is key regulator of entry into cell division that acts as a tumor suppressor. It promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. It acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. It controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex By similarity.
• Protein Interactions: Prkcb; Pax2; Prmt2; CDK4; CDK2; Mrfap1; Morf4l1; Jarid2; Cebpd; Cebpb; Cebpa; Neurod1; Cdk6; Rbak; PPP1CA; Cdk9; Ccnd1; Psmd10; Ppp1cc; CSNK2A1; Cdkn1b; E2f1; Suv420h2; Suv420h1; Hdac1; Ubtf; Hmga2; Id2; Hmga1; Runx2; E2f2; ZFPM1; GATA1; TP53BP1; Smarca4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Rb1 (ARP33211_P050) antibody is Catalog # AAP33211
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Rb1
• Uniprot ID: P13405
• Protein Name: Retinoblastoma-associated protein
• Protein Accession #: NP_033055
• Purification: Affinity Purified
• Nucleotide Accession #: NM_009029
• Tested Species Reactivity: Mouse
• Gene Symbol: Rb1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
• Image 1: Mouse Heart
  
  Host: Rabbit
  Target Name: Rb1
  Sample Type: Mouse Heart lysates
  Antibody Dilution: 1.0ug/ml
• Image 2: Mouse Brain
  
  Host: Rabbit
  Target Name: RB1
  Sample Tissue: Mouse Brain
  Antibody Dilution: 7ug/ml