TBX20 Antibody - N-terminal region : HRP (ARP33176_P050-HRP)

• Product Number: ARP33176_P050-HRP
• Name: TBX20 Antibody - N-terminal region : HRP (ARP33176_P050-HRP)
• Protein Size (# AA): 447 amino acids
• Molecular Weight: 49kDa
• Conjugation: HRP: Horseradish Peroxidase
• NCBI Gene Id: 57057
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: ASD4
• Peptide Sequence: Synthetic peptide located within the following region: RANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDA
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Reference: N/A
• Description of Target: This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: UBC; ZSCAN1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-TBX20 (ARP33176_P050-HRP) antibody is Catalog # AAP33176
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TBX20
• Uniprot ID: Q9UMR3
• Purification: Affinity purified
• Gene Symbol: TBX20
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: