TBX20 Antibody - N-terminal region : Biotin (ARP33176_P050-Biotin)

Data Sheet
 
Product Number ARP33176_P050-Biotin
Product Page www.avivasysbio.com/tbx20-antibody-n-terminal-region-biotin-arp33176-p050-biotin.html
Name TBX20 Antibody - N-terminal region : Biotin (ARP33176_P050-Biotin)
Protein Size (# AA) 447 amino acids
Molecular Weight 49kDa
Conjugation Biotin
NCBI Gene Id 57057
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols ASD4
Peptide Sequence Synthetic peptide located within the following region: RANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions UBC; ZSCAN1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TBX20 (ARP33176_P050-Biotin) antibody
Blocking Peptide For anti-TBX20 (ARP33176_P050-Biotin) antibody is Catalog # AAP33176
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TBX20
Uniprot ID Q9UMR3
Purification Affinity purified
Gene Symbol TBX20
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com