RNASET2 Antibody - middle region (ARP33127_P050)

• Product Number: ARP33127_P050
• Name: RNASET2 Antibody - middle region (ARP33127_P050)
• Protein Size (# AA): 256 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 8635
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ribonuclease T2
• Alias Symbols: RNASE6PL, bA514O12.3
• Peptide Sequence: Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Campomenosi,P., Arch. Biochem. Biophys. 449 (1-2), 17-26 (2006)
• Description of Target: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
• Protein Interactions: FBXO6; UBC; NIT2; PRDX3; SLC9A3R1; SUCLG2; MRPL12; NDUFV1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RNASET2 (ARP33127_P050) antibody is Catalog # AAP33127 (Previous Catalog # AAPP04160)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASET2
• Uniprot ID: O00584
• Protein Name: Ribonuclease T2
• Sample Type Confirmation:

  RNASET2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_003721
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003730
• Tested Species Reactivity: Human
• Gene Symbol: RNASET2
• Predicted Species Reactivity: Human, Rat, Dog, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Horse: 79%; Human: 100%; Rat: 75%
• Image 1: Human HEK293T
  
  WB Suggested Anti-RNASET2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 293T cell lysateRNASET2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
• Image 2: Human Lung Tissue
  
  Rabbit Anti-RNASET2 Antibody
  Catalog Number: ARP33127_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasmic in in alveolar cells, type I and II
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec