Product Number |
ARP33121_P050 |
Product Page |
www.avivasysbio.com/fa2h-antibody-c-terminal-region-arp33121-p050.html |
Name |
Fa2h Antibody - C-terminal region (ARP33121_P050) |
Protein Size (# AA) |
372 amino acids |
Molecular Weight |
43 kDa |
NCBI Gene Id |
338521 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Fatty acid 2-hydroxylase |
Description |
|
Alias Symbols |
FAAH, Faxdc, Faxdc1, G630055L08Rik |
Peptide Sequence |
Synthetic peptide located within the following region: HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Fa2h is required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Fa2h (ARP33121_P050) antibody |
Blocking Peptide |
For anti-Fa2h (ARP33121_P050) antibody is Catalog # AAP33121 (Previous Catalog # AAPY00105) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q5MPP0 |
Protein Name |
Fatty acid 2-hydroxylase |
Publications |
Characterization of the endocannabinoid system in subcutaneous adipose tissue in periparturient dairy cows and its association to metabolic profiles. PLoS One. 13, e0205996 (2018). 30403679
Phosphoproteomic Analysis of Subcutaneous and Omental Adipose Tissue Reveals Increased Lipid Turnover in Dairy Cows Supplemented with Conjugated Linoleic Acid. Int J Mol Sci. 22 (2021). 33810070 |
Protein Accession # |
NP_835187 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_178086 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Fa2h |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Mouse Liver
| WB Suggested Anti-Fa2h Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Mouse liver |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|