Fa2h Antibody - C-terminal region (ARP33121_P050)

Data Sheet
 
Product Number ARP33121_P050
Product Page www.avivasysbio.com/fa2h-antibody-c-terminal-region-arp33121-p050.html
Name Fa2h Antibody - C-terminal region (ARP33121_P050)
Protein Size (# AA) 372 amino acids
Molecular Weight 43 kDa
NCBI Gene Id 338521
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Fatty acid 2-hydroxylase
Description
Alias Symbols FAAH, Faxdc, Faxdc1, G630055L08Rik
Peptide Sequence Synthetic peptide located within the following region: HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Fa2h is required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Fa2h (ARP33121_P050) antibody
Blocking Peptide For anti-Fa2h (ARP33121_P050) antibody is Catalog # AAP33121 (Previous Catalog # AAPY00105)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q5MPP0
Protein Name Fatty acid 2-hydroxylase
Publications

Characterization of the endocannabinoid system in subcutaneous adipose tissue in periparturient dairy cows and its association to metabolic profiles. PLoS One. 13, e0205996 (2018). 30403679

Phosphoproteomic Analysis of Subcutaneous and Omental Adipose Tissue Reveals Increased Lipid Turnover in Dairy Cows Supplemented with Conjugated Linoleic Acid. Int J Mol Sci. 22 (2021). 33810070

Protein Accession # NP_835187
Purification Affinity Purified
Nucleotide Accession # NM_178086
Tested Species Reactivity Mouse
Gene Symbol Fa2h
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Mouse Liver
WB Suggested Anti-Fa2h Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse liver
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com