| Product Number |
ARP33064_P050 |
| Product Page |
www.avivasysbio.com/pou4f3-antibody-n-terminal-region-arp33064-p050.html |
| Name |
Pou4f3 Antibody - N-terminal region (ARP33064_P050) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
18998 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
POU domain, class 4, transcription factor 3 |
| Alias Symbols |
Brn, ddl, Brn3, Brn-3, Brn3c, Brn3.1, dreidel |
| Peptide Sequence |
Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pou4f3 (ARP33064_P050) antibody |
| Blocking Peptide |
For anti-Pou4f3 (ARP33064_P050) antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175) |
| Uniprot ID |
Q63955 |
| Protein Name |
POU domain, class 4, transcription factor 3 |
| Protein Accession # |
NP_620395 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138945 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Pou4f3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Pou4f3 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
