| Product Number |
ARP32990_P050 |
| Product Page |
www.avivasysbio.com/sox30-antibody-middle-region-arp32990-p050.html |
| Name |
SOX30 Antibody - middle region (ARP32990_P050) |
| Protein Size (# AA) |
501 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
11063 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SRY (sex determining region Y)-box 30 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: GDEKGKLEAEEVMRDSMQGGAGKSPAAIREGVIKTEEPERLLEDCRLGAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Koopman,P., Gene 328, 177-186 (2004) |
| Description of Target |
The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
C6orf165; AHCYL1; FLI1; GNAI3; FBXO38; DDX56; DCAF4; CUL5; NME1; KIFC3; GP2; PAXIP1; BRCA1; NUDT3; BAMBI; TRAF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX30 (ARP32990_P050) antibody |
| Blocking Peptide |
For anti-SOX30 (ARP32990_P050) antibody is Catalog # AAP32990 (Previous Catalog # AAPP04019) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SOX30 |
| Uniprot ID |
O94993-2 |
| Protein Name |
Transcription factor SOX-30 |
| Protein Accession # |
NP_008948 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007017 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SOX30 |
| Predicted Species Reactivity |
Human, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Human: 100%; Pig: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
