JMJD2C Antibody - C-terminal region (ARP32974_P050)

• Product Number: ARP32974_P050
• Name: JMJD2C Antibody - C-terminal region (ARP32974_P050)
• Protein Size (# AA): 813 amino acids
• Molecular Weight: 92 kDa
• NCBI Gene Id: 23081
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lysine (K)-specific demethylase 4C
• Alias Symbols: GASC1, JHDM3C, JMJD2C, TDRD14C
• Peptide Sequence: Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: JMJD2C is a member of the Jumonji domain 2 (JMJD2) family. It contains one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.
• Protein Interactions: UBC; HIST2H3C; HDAC3; PPARG; HDAC1; H3F3A; HIST1H3A; KDM4C; KDM4A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-KDM4C (ARP32974_P050) antibody is Catalog # AAP32974 (Previous Catalog # AAPP04002)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C
• Uniprot ID: F5H347
• Protein Name: Lysine-specific demethylase 4C Ensembl ENSP00000445427
• Publications:

  Lu, C. et al. IDH mutation impairs histone demethylation and results in a block to cell differentiation. Nature 483, 474-8 (2012). 22343901

• Protein Accession #: NP_001140167
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001146695
• Tested Species Reactivity: Human
• Gene Symbol: KDM4C
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 92 kDa isoform is identified, and a second isoform of ~90 kDa is also present in some samples.