JMJD1A antibody - C-terminal region (ARP32911_T100)
Data Sheet
Product Number ARP32911_T100
Product Page
Product Name JMJD1A antibody - C-terminal region (ARP32911_T100)
Size 100 ul
Gene Symbol KDM3A
Protein Size (# AA) 1321 amino acids
Molecular Weight 147kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 55818
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Lysine (K)-specific demethylase 3A
Description This is a rabbit polyclonal antibody against JMJD1A. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
Target Reference Katoh,M. et al., (2003) Int. J. Mol. Med. 12 (5), 817-821
Description of Target JMJD1A is a zinc finger protein that contains a jumonji domain.
Protein Interactions RIPK2; HIST2H3C; CBX2; CBX4; AR; HIF1A; UBC; MYOCD; MKL1; MKL2; ETV2; TCEAL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-KDM3A (ARP32911_T100) antibody is Catalog # AAP32911 (Previous Catalog # AAPP03935)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Complete computational species homology data Anti-JMJD1A (ARP32911_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express JMJD1A.
Swissprot Id Q53S72
Protein Name Lysine-specific demethylase 3A

Zhou, X., Sun, H., Ellen, T. P., Chen, H. & Costa, M. Arsenite alters global histone H3 methylation. Carcinogenesis 29, 1831-6 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18321869

Sample Type Confirmation

KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_060903
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express JMJD1A.
Nucleotide Accession # NM_018433
Conjugation Options

ARP32911_T100-FITC Conjugated

ARP32911_T100-HRP Conjugated

ARP32911_T100-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Smooth Muscle
Human Smooth Muscle
Image 2
Human kidney
Human kidney
Image 3
Human Jurkat
WB Suggested Anti-JMJD1A Antibody Titration: 1.0ug/ml
Positive Control: Jurkat cell lysateKDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |