Product Number |
ARP32811_P050 |
Product Page |
www.avivasysbio.com/avil-antibody-middle-region-arp32811-p050.html |
Name |
AVIL Antibody - middle region (ARP32811_P050) |
Protein Size (# AA) |
819 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
10677 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Advillin |
Alias Symbols |
p92, DOC6, ADVIL, NPHS21 |
Peptide Sequence |
Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470 |
Description of Target |
AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia. |
Protein Interactions |
UBC; CRK; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AVIL (ARP32811_P050) antibody |
Blocking Peptide |
For anti-AVIL (ARP32811_P050) antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AVIL |
Uniprot ID |
O75366 |
Protein Name |
Advillin |
Protein Accession # |
NP_006567 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006576 |
Tested Species Reactivity |
Human |
Gene Symbol |
AVIL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92% |
Image 1 | Human Placenta
| WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Placenta |
|
|