| Product Number |
ARP32795_P050 |
| Product Page |
www.avivasysbio.com/me1-antibody-c-terminal-region-arp32795-p050.html |
| Name |
ME1 Antibody - C-terminal region (ARP32795_P050) |
| Protein Size (# AA) |
406 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
4199 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
malic enzyme 1, NADP(+)-dependent, cytosolic |
| Alias Symbols |
MES, HUMNDME |
| Peptide Sequence |
Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ME1 (ARP32795_P050) antibody |
| Blocking Peptide |
For anti-ME1 (ARP32795_P050) antibody is Catalog # AAP32795 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ME1 |
| Uniprot ID |
P48163 |
| Protein Name |
NADP-dependent malic enzyme |
| Protein Accession # |
NP_002386.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002395.5 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ME1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Goat: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 100%; Sheep: 85% |
| Image 1 | Human Lymph Node Tumor
 | Host: Rabbit
Target Name: ME1
Sample Type: Lymph Node Tumor lysates
Antibody Dilution: 1.0ug/ml |
|
|
