| Product Number |
ARP32794_P050 |
| Product Page |
www.avivasysbio.com/me1-antibody-n-terminal-region-arp32794-p050.html |
| Name |
ME1 Antibody - N-terminal region (ARP32794_P050) |
| Protein Size (# AA) |
572 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
4199 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Malic enzyme 1, NADP(+)-dependent, cytosolic |
| Alias Symbols |
MES, HUMNDME |
| Peptide Sequence |
Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hsieh,J.Y., (2006) J. Biol. Chem. 281 (32), 23237-23245 |
| Description of Target |
ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; VTA1; RPUSD2; GORASP2; BOP1; TOM1; NMI; CUL3; UGDH; TBCD; GTF2A1; GARS; CTTN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ME1 (ARP32794_P050) antibody |
| Blocking Peptide |
For anti-ME1 (ARP32794_P050) antibody is Catalog # AAP32794 (Previous Catalog # AAPP03813) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ME1 |
| Uniprot ID |
P48163 |
| Protein Name |
NADP-dependent malic enzyme |
| Sample Type Confirmation |
ME1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_002386 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002395 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ME1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 100%; Rat: 100%; Sheep: 92% |
| Image 1 | Human Bronchial Epithelial Tissue
 | Rabbit Anti-ME1 Antibody
Catalog Number: ARP32794_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
| Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a 55 kDa isoform.
|
|
