PIAS3 Antibody - middle region (ARP32763_P050)

Data Sheet
 
Product Number ARP32763_P050
Product Page www.avivasysbio.com/pias3-antibody-middle-region-arp32763-p050.html
Name PIAS3 Antibody - middle region (ARP32763_P050)
Protein Size (# AA) 628 amino acids
Molecular Weight 68kDa
NCBI Gene Id 10401
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein inhibitor of activated STAT, 3
Alias Symbols ZMIZ5
Peptide Sequence Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357
Description of Target PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; HIC1; TRIM63; TRIM55; TAB2; SUMO1; CBS; SUMO2; SUMO3; STAT3; NCOA2; CREM; PRPF40A; SERPINA10; GEMIN4; UBE2I; SKIL; HNRNPK; ZFHX3; SERBP1; SATB1; ERBB4; Bcl11a; ELAVL1; PPP1CA; Grm7; Grm8; Grm6; Grm4; TRIM8; RAC1; C19orf60; CARHSP1; UBA1; PSMC1; TRIM2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PIAS3 (ARP32763_P050) antibody
Blocking Peptide For anti-PIAS3 (ARP32763_P050) antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PIAS3
Uniprot ID Q9Y6X2
Protein Name E3 SUMO-protein ligase PIAS3
Protein Accession # NP_006090
Purification Affinity Purified
Nucleotide Accession # NM_006099
Tested Species Reactivity Human
Gene Symbol PIAS3
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
Image 1
Human Spleen
WB Suggested Anti-PIAS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com