OLIG2 antibody - N-terminal region (ARP32752_P050)
Data Sheet
Product Number ARP32752_P050
Product Page www.avivasysbio.com/olig2-antibody-n-terminal-region-arp32752-p050.html
Product Name OLIG2 antibody - N-terminal region (ARP32752_P050)
Size 100 ul
Gene Symbol OLIG2
Alias Symbols BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Protein Size (# AA) 323 amino acids
Molecular Weight 32kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10215
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Oligodendrocyte lineage transcription factor 2
Description This is a rabbit polyclonal antibody against OLIG2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Target Reference Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)
Description of Target OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-OLIG2 (ARP32752_P050) antibody is Catalog # AAP32752 (Previous Catalog # AAPP03766)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
Complete computational species homology data Anti-OLIG2 (ARP32752_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OLIG2.
Swissprot Id Q13516
Protein Name Oligodendrocyte transcription factor 2
Protein Accession # NP_005797
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OLIG2.
Nucleotide Accession # NM_005806
Replacement Item This antibody may replace item sc-133869 from Santa Cruz Biotechnology.
Conjugation Options

ARP32752_P050-FITC Conjugated

ARP32752_P050-HRP Conjugated

ARP32752_P050-Biotin Conjugated

CB Replacement sc-133869; sc-19967; sc-19969; sc-293163; sc-48817
CB Tag transcription factor
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human optic nerve
Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage CellsDilution: 1:500
Image 3
Mouse Heart
Host: Rabbit
Target Name: OLIG2
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml
Image 4
Mouse Heart
Host: Mouse
Target Name: OLIG2
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com