PAX7 Antibody - C-terminal region (ARP32742_P050)

• Product Number: ARP32742_P050
• Name: PAX7 Antibody - C-terminal region (ARP32742_P050)
• Protein Size (# AA): 520 amino acids
• Molecular Weight: 57kDa
• NCBI Gene Id: 5081
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Paired box 7
• Description:
  View product citations for PAX7 Antibody - C-terminal region (ARP32742_P050) on CiteAb
• Alias Symbols: HUP1, RMS2, PAX7B, MYOSCO
• Peptide Sequence: Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
• Protein Interactions: TRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of PAX7
• Uniprot ID: P23759
• Protein Name: Paired box protein Pax-7
• Publications:

  A collagen domain-derived short adiponectin peptide activates APPL1 and AMPK signaling pathways and improves glucose and fatty acid metabolisms. J Biol Chem. 293, 13509-13523 (2018). 29991592

  CD163 interacts with TWEAK to regulate tissue regeneration after ischaemic injury. Nat Commun. 6, 7792 (2015). 26242746

  Cell cycle regulation of embryonic stem cells and mouse embryonic fibroblasts lacking functional Pax7. Cell Cycle. 15, 2931-2942 (2016). 27610933

  Cell-autonomous Notch activity maintains the temporal specification potential of skeletal muscle stem cells. Development. 139, 4536-48 (2012). 23136394

  Early myogenic responses to acute exercise before and after resistance training in young men. Physiol Rep. 3, (2015). 26359239

  Embryonic founders of adult muscle stem cells are primed by the determination gene Mrf4. Dev Biol. 381, 241-55 (2013). 23623977

  First Neuromuscular Contact Correlates with Onset of Primary Myogenesis in Rat and Mouse Limb Muscles. PLoS One. 10, e0133811 (2015). 26207754

  Klotho gene silencing promotes pathology in the mdx mouse model of Duchenne muscular dystrophy. Hum. Mol. Genet. 25, 2465-2482 (2016). 27154199

  Laminin differentially regulates the stemness of type I and type II pericytes. Stem Cell Res Ther. 8, 28 (2017). 28173861

  McDonald, A. A., Kunz, M. D. & McLoon, L. K. Dystrophic changes in extraocular muscles after gamma irradiation in mdx:utrophin(+/-) mice. PLoS One 9, e86424 (2014). 24466085

  PAX3 Confers Functional Heterogeneity in Skeletal Muscle Stem Cell Responses to Environmental Stress. Cell Stem Cell. 24, 958-973.e9 (2019). 31006622

  Pax7-expressing satellite cells are indispensable for adult skeletal muscle regeneration. Development. 138, 3647-56 (2011). 21828093

  Sparing of the extraocular muscles in mdx mice with absent or reduced utrophin expression: A life span analysis. Neuromuscul. Disord. 25, 873-87 (2015). 26429098

  The primary cilium dampens proliferative signaling and represses a G2/M transcriptional network in quiescent myoblasts. BMC Mol Cell Biol. 21, 25 (2020). 32293249

  The role of Pitx2 and Pitx3 in muscle stem cells gives new insights into P38a MAP kinase and redox regulation of muscle regeneration. Elife. 7, (2018). 30106373

  The transcription factor Lef1 switches partners from β-catenin to Smad3 during muscle stem cell quiescence. Sci Signal. 11, NULL (2018). 30042129

• Protein Accession #: NP_002575
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002584
• Tested Species Reactivity: Human
• Gene Symbol: PAX7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Fetal heart
  
  Host: Rabbit
  Target Name: PAX7
  Sample Type: Fetal heart lysates
  Antibody Dilution: 1.0ug/ml
• Image 2:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.