PAX4 Antibody - N-terminal region (ARP32737_P050)

• Product Number: ARP32737_P050
• Name: PAX4 Antibody - N-terminal region (ARP32737_P050)
• Protein Size (# AA): 343 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 5078
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Paired box 4
• Alias Symbols: KPD, MODY9
• Peptide Sequence: Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Brun,T., (2008) Hum. Mol. Genet. 17 (4), 478-489
• Description of Target: PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells. This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: GMCL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PAX4 (ARP32737_P050) antibody is Catalog # AAP32737 (Previous Catalog # AAPP03751)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAX4
• Uniprot ID: O43316-4
• Protein Name: Paired box protein Pax-4
• Protein Accession #: NP_006184
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006193
• Tested Species Reactivity: Human
• Gene Symbol: PAX4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93%
• Image 1: Human Stomach
  
  WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Stomach