NFIX Antibody - middle region (ARP32717_P050)

Data Sheet
 
Product Number ARP32717_P050
Product Page www.avivasysbio.com/nfix-antibody-middle-region-arp32717-p050.html
Name NFIX Antibody - middle region (ARP32717_P050)
Protein Size (# AA) 441 amino acids
Molecular Weight 49kDa
NCBI Gene Id 4784
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear factor I/X (CCAAT-binding transcription factor)
Alias Symbols CTF, NF1A, NF1-X, MRSHSS, NF-I/X, SOTOS2
Peptide Sequence Synthetic peptide located within the following region: YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Norquay,L.D., et al., (2003) Mol. Endocrinol. 17 (6), 1027-1038
Description of Target Nuclear factor I (NFI) proteins constitute a family of sequence-specific transcription factors whose functional diversity is generated through transcription from four different genes (NFI-A, NFI-B, NFI-C, and NFI-X), alternative RNA splicing, and protein heterodimerization. NFI-X has divergent functions after binding in promoter or enhancer position. This property, combined with the differential expression of NFI-X, can achieve cell-type specificity of NFI dependent promoters and enhancers.
Protein Interactions QRICH1; NFIX; ZNF614; SUMO1; UBC; NEDD8; JMJD6; ISG15; NFIB; PIR; RFX1; SKI; RB1; HDAC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NFIX (ARP32717_P050) antibody
Blocking Peptide For anti-NFIX (ARP32717_P050) antibody is Catalog # AAP32717 (Previous Catalog # AAPP03731)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NFIX
Uniprot ID Q14938-3
Protein Name Nuclear factor 1 X-type
Protein Accession # NP_002492
Purification Affinity Purified
Nucleotide Accession # NM_002501
Tested Species Reactivity Human, Mouse
Gene Symbol NFIX
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
mouse hippocampus
DG of Hippocampus
Dilution: 1:200
Image 2
Human Prostate
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-NFIX antibody (ARP32717_P050)
Image 3
Human Jurkat
WB Suggested Anti-NFIX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com