| Product Number |
ARP32711_P050 |
| Product Page |
www.avivasysbio.com/myt1-antibody-n-terminal-region-arp32711-p050.html |
| Name |
MYT1 Antibody - N-terminal region (ARP32711_P050) |
| Protein Size (# AA) |
1121 amino acids |
| Molecular Weight |
122kDa |
| NCBI Gene Id |
4661 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Myelin transcription factor 1 |
| Alias Symbols |
MTF1, MYTI, NZF2, PLPB1, ZC2H2C1, ZC2HC4A, C20orf36 |
| Peptide Sequence |
Synthetic peptide located within the following region: CTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Vana,A.C., (2007) Glia 55 (7), 687-697 |
| Description of Target |
The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing ne |
| Protein Interactions |
TRAF3; SIN3B; HDAC1; PLK1; CDK1; PIN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MYT1 (ARP32711_P050) antibody |
| Blocking Peptide |
For anti-MYT1 (ARP32711_P050) antibody is Catalog # AAP32711 (Previous Catalog # AAPP03725) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MYT1 |
| Uniprot ID |
Q01538 |
| Protein Name |
Myelin transcription factor 1 |
| Protein Accession # |
NP_004526 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004535 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MYT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human THP1
 | WB Suggested Anti-MYT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate |
|
| Image 2 | Human
 | Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage cells
Dilution: 1:1000 |
|
