| Product Number |
ARP32689_P050 |
| Product Page |
www.avivasysbio.com/smad6-antibody-c-terminal-region-arp32689-p050.html |
| Name |
Smad6 Antibody - C-terminal region (ARP32689_P050) |
| Protein Size (# AA) |
459 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
17130 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SMAD family member 6 |
| Alias Symbols |
Madh, Madh6, b2b390C, b2b390Clo |
| Peptide Sequence |
Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Smad6 binds to regulatory elements in target promoter regions. It may block the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. It acts as a mediator of TGF-beta and BMP antiflammatory activity. It suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes. |
| Protein Interactions |
Smurf1; Tbx6; Bmpr2; Bmpr1a; Acvr1; Runx2; tob1a; Axin1; SMURF2; BMPR1B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SMAD6 (ARP32689_P050) antibody |
| Blocking Peptide |
For anti-SMAD6 (ARP32689_P050) antibody is Catalog # AAP32689 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Smad6 |
| Uniprot ID |
O35182 |
| Protein Name |
Mothers against decapentaplegic homolog 6 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Smad6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Mouse Kidney
 | Host: Rabbit
Target Name: SMAD6
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml |
|
|
