CNOT7 Antibody - middle region (ARP32607_P050)

Data Sheet
 
Product Number ARP32607_P050
Product Page www.avivasysbio.com/cnot7-antibody-middle-region-arp32607-p050.html
Name CNOT7 Antibody - middle region (ARP32607_P050)
Protein Size (# AA) 285 amino acids
Molecular Weight 33kDa
NCBI Gene Id 29883
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CCR4-NOT transcription complex, subunit 7
Alias Symbols CAF1, CAF-1, Caf1a, hCAF-1
Peptide Sequence Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.
Protein Interactions FBXW11; TOB2; BTG2; FOXC2; UBC; BAG3; CNOT6; AGO2; AGO1; EPAS1; APP; ELAVL1; BTG1; Cnot3; HOXD4; IKBKG; BTG3; TOB1; CDK6; CDK4; CDK2; CDK1; PABPC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CNOT7 (ARP32607_P050) antibody
Blocking Peptide For anti-CNOT7 (ARP32607_P050) antibody is Catalog # AAP32607 (Previous Catalog # AAPP03615)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CNOT7
Uniprot ID Q9UIV1
Protein Name CCR4-NOT transcription complex subunit 7
Protein Accession # NP_037486
Purification Affinity Purified
Nucleotide Accession # NM_013354
Tested Species Reactivity Human
Gene Symbol CNOT7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Image 1
Human Placenta
WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com