Product Number |
ARP32527_P050-HRP |
Product Page |
www.avivasysbio.com/znf776-antibody-middle-region-hrp-arp32527-p050-hrp.html |
Name |
ZNF776 Antibody - middle region : HRP (ARP32527_P050-HRP) |
Protein Size (# AA) |
518 amino acids |
Molecular Weight |
56kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
284309 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
ZNF776, |
Peptide Sequence |
Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Description of Target |
ZNF776 may be involved in transcriptional regulation. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF776 (ARP32527_P050-HRP) antibody |
Blocking Peptide |
For anti-ZNF776 (ARP32527_P050-HRP) antibody is Catalog # AAP32527 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776 |
Uniprot ID |
Q68DI1 |
Protein Accession # |
NP_775903 |
Purification |
Affinity Purified |
Gene Symbol |
ZNF776 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|