ZNF776 Antibody - middle region : HRP (ARP32527_P050-HRP)

Data Sheet
 
Product Number ARP32527_P050-HRP
Product Page www.avivasysbio.com/znf776-antibody-middle-region-hrp-arp32527-p050-hrp.html
Name ZNF776 Antibody - middle region : HRP (ARP32527_P050-HRP)
Protein Size (# AA) 518 amino acids
Molecular Weight 56kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 284309
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols ZNF776,
Peptide Sequence Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Description of Target ZNF776 may be involved in transcriptional regulation.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ZNF776 (ARP32527_P050-HRP) antibody
Blocking Peptide For anti-ZNF776 (ARP32527_P050-HRP) antibody is Catalog # AAP32527
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776
Uniprot ID Q68DI1
Protein Accession # NP_775903
Purification Affinity Purified
Gene Symbol ZNF776
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com