EHMT2 Antibody - N-terminal region (ARP32493_P050)

• Product Number: ARP32493_P050
• Name: EHMT2 Antibody - N-terminal region (ARP32493_P050)
• Protein Size (# AA): 1210 amino acids
• Molecular Weight: 132kDa
• NCBI Gene Id: 10919
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Euchromatic histone-lysine N-methyltransferase 2
• Alias Symbols: G9A, BAT8, GAT8, NG36, KMT1C, C6orf30
• Peptide Sequence: Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kondo,Y., (er) PLoS ONE 3 (4), E2037 (2008)
• Description of Target: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction. There are three alternatively spliced transcript variants of this gene but only two are fully described.
• Protein Interactions: PLOD3; NAA10; PSMA1; MX2; ITGB5; RD3; ZBTB38; ZNF785; NAPRT; FAM161A; KLF3; CHCHD2; C10orf12; DNMT1; PML; HIST2H3A; HIST1H1A; PRDM1; XAGE2; EED; RNF2; CTNNA3; SOX2; HDAC1; CBX5; CBX3; CBX1; REST; EHMT1; WIZ; MIER1; EHMT2; CDYL; UBC; HDAC2; HIST2H3C; CUX1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EHMT2 (ARP32493_P050) antibody is Catalog # AAP32493 (Previous Catalog # AAPP03492)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
• Uniprot ID: Q96KQ7
• Protein Name: Histone-lysine N-methyltransferase EHMT2
• Protein Accession #: NP_006700
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006709
• Tested Species Reactivity: Human
• Gene Symbol: EHMT2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB, CHIP
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%
• Image 1: Human Muscle
  
  WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Muscle
• Image 2: HCT116
  
  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
• Image 3: human RKO
  
  WB Suggested Anti-EHMT2 Antibody
  Positive Control: Lane 1: 30ug human RKO lysate
  Primary Antibody Dilution : 1:1000
  Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680
  Secondry Antibody Dilution : 1:5000
  Submitted by: Dr. Syed Morshed