PITX2 Antibody - N-terminal region (ARP32432_P050)

• Product Number: ARP32432_P050
• Name: PITX2 Antibody - N-terminal region (ARP32432_P050)
• Protein Size (# AA): 317 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 5308
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Paired-like homeodomain 2
• Alias Symbols: RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1
• Peptide Sequence: Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Holmberg,J., (er) BMC Dev. Biol. 8, 25 (2008)
• Description of Target: The PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Protein Interactions: LEF1; Hoxa1; WDR5; SMAD3; HDAC1; CTNNB1; ZNHIT3; TRIM25; HERC5; PDLIM1; PITX2; PROP1; KAT5; Pou1f1; MSX2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PITX2 (ARP32432_P050) antibody is Catalog # AAP32432 (Previous Catalog # AAPP03428)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
• Uniprot ID: Q99697
• Protein Name: Pituitary homeobox 2
• Protein Accession #: NP_700475
• Purification: Affinity Purified
• Nucleotide Accession #: NM_153426
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: PITX2
• Predicted Species Reactivity: Human, Mouse, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 86%; Human: 100%; Mouse: 93%
• Image 1: Human Heart
  
  WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:31250
  Positive Control: Human heart
• Image 2: Mouse Brain
  
  Host: Mouse
  Target Name: PITX2
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml