SIRT6 Antibody - N-terminal region (ARP32409_T100)

Data Sheet
 
Product Number ARP32409_T100
Product Page www.avivasysbio.com/sirt6-antibody-n-terminal-region-arp32409-t100.html
Name SIRT6 Antibody - N-terminal region (ARP32409_T100)
Protein Size (# AA) 355 amino acids
Molecular Weight 39kDa
NCBI Gene Id 51548
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Sirtuin 6
Alias Symbols SIR2L6
Peptide Sequence Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Frye,R.A., (2000) Biochem Biophys Res Commun. 273(2), 793-8
Description of Target SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family.
Protein Interactions UBC; MDM2; AKT1; STUB1; SKP2; ABCF2; FAF1; VIM; UBE2D1; CHD3; NR0B2; tat; CCNDBP1; RELA; XRCC5; PRKDC; XRCC6; ELF5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIRT6 (ARP32409_T100) antibody
Blocking Peptide For anti-SIRT6 (ARP32409_T100) antibody is Catalog # AAP32409 (Previous Catalog # AAPP03404)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT6
Uniprot ID Q8N6T7
Protein Name NAD-dependent protein deacetylase sirtuin-6
Protein Accession # NP_057623
Purification Protein A purified
Nucleotide Accession # NM_016539
Tested Species Reactivity Human, Mouse
Gene Symbol SIRT6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-SIRT6 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human U2OS
U2OS
Image 3
Mouse Skeletal Muscle
Host: Mouse
Target Name: SIRT6
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com