| Product Number |
ARP32365_P050 |
| Product Page |
www.avivasysbio.com/atoh1-antibody-middle-region-arp32365-p050.html |
| Name |
ATOH1 Antibody - middle region (ARP32365_P050) |
| Protein Size (# AA) |
354 amino acids |
| Molecular Weight |
38 kDa |
| NCBI Gene Id |
474 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Atonal homolog 1 (Drosophila) |
| Description |
|
| Alias Symbols |
ATH1, HATH1, MATH-1, bHLHa14 |
| Peptide Sequence |
Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Aragaki,M., (2008) Biochem. Biophys. Res. Commun. 368 (4), 923-929 |
| Description of Target |
ATOH1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
HMGB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| SPR Affinity Characterization |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-ATOH1 (ARP32365_P050) antibody |
| Blocking Peptide |
For anti-ATOH1 (ARP32365_P050) antibody is Catalog # AAP32365 (Previous Catalog # AAPP03354) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ATOH1 |
| Uniprot ID |
Q92858 |
| Protein Name |
Protein atonal homolog 1 |
| Publications |
Regenerating hair cells in vestibular sensory epithelia from humans. Elife. 7, (2018). 30019672 |
| Protein Accession # |
NP_005163 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005172 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
ATOH1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 83%; Rat: 77% |
| Image 1 | Human Fetal Lung
 | Host: Rabbit
Target Name: ATOH1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Liver
 | Immunohistochemistry with Liver cell lysate tissue |
|
| Image 3 | Human Spleen
 | Immunohistochemistry with Spleen cell lysate tissue |
|
| Image 4 | mouse cochlea
 | mouse cochlea |
|
| Image 5 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: ATOH1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 6 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|
