ETV4 Antibody - middle region (ARP32263_P050)

Data Sheet
 
Product Number ARP32263_P050
Product Page www.avivasysbio.com/etv4-antibody-middle-region-arp32263-p050.html
Name ETV4 Antibody - middle region (ARP32263_P050)
Protein Size (# AA) 484 amino acids
Molecular Weight 54kDa
NCBI Gene Id 2118
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ets variant 4
Description
Alias Symbols E1AF, PEA3, E1A-F, PEAS3
Peptide Sequence Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Span,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131
Description of Target The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Protein Interactions STK11; RFWD2; TP63; ATXN1; HTT; APP; UBC; SMAD2; SUMO2; SUMO1; SAE1; UBA2; HOXD4; EP300; SRF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ETV4 (ARP32263_P050) antibody
Blocking Peptide For anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ETV4
Uniprot ID P43268
Protein Name ETS translocation variant 4
Publications

An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. Cell Rep. 17, 1289-1301 (2016). 27783944

Capicua regulates neural stem cell proliferation and lineage specification through control of Ets factors. Nat Commun. 10, 2000 (2019). 31043608

Dynamics of chromatin accessibility during TGF-β-induced EMT of Ras-transformed mammary gland epithelial cells. Sci Rep. 7, 1166 (2017). 28446749

ETV4 Is Necessary for Estrogen Signaling and Growth in Endometrial Cancer Cells. Cancer Res. 80, 1234-1245 (2020). 32046982

Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). 22012618

Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). 21373373

Inactivation of Capicua drives cancer metastasis. Nat. Genet. 49, 87-96 (2017). 27869830

Interaction of BRAF-induced ETS factors with mutant TERT promoter in papillary thyroid cancer. Endocr Relat Cancer. 26, 629-641 (2019). 30999281

ME1 Regulates NADPH Homeostasis to Promote Gastric Cancer Growth and Metastasis. Cancer Res. 78, 1972-1985 (2018). 29654155

Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). 24642271

Protein Accession # NP_001977
Purification Affinity Purified
Nucleotide Accession # NM_001986
Tested Species Reactivity Human
Gene Symbol ETV4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Small Intestine
WB Suggested Anti-ETV4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine
Image 2
Human Jurkat Whole Cell
Host: Rabbit
Target Name: ETV4
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com