| Product Number |
ARP32229_P050-FITC |
| Product Page |
www.avivasysbio.com/znf618-antibody-middle-region-fitc-arp32229-p050-fitc.html |
| Name |
ZNF618 Antibody - middle region : FITC (ARP32229_P050-FITC) |
| Protein Size (# AA) |
954 amino acids |
| Molecular Weight |
104kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
114991 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
zinc finger protein 618 |
| Alias Symbols |
NEDD10, FP13169 |
| Peptide Sequence |
Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Protein Interactions |
CSNK1A1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF618 (ARP32229_P050-FITC) antibody |
| Blocking Peptide |
For anti-ZNF618 (ARP32229_P050-FITC) antibody is Catalog # AAP32229 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human ZN618 |
| Uniprot ID |
Q5T7W0 |
| Protein Name |
zinc finger protein 618 |
| Purification |
Affinity purified |
| Gene Symbol |
ZNF618 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
