Product Number |
ARP32134_P050 |
Product Page |
www.avivasysbio.com/myf5-antibody-n-terminal-region-arp32134-p050.html |
Name |
MYF5 Antibody - N-terminal region (ARP32134_P050) |
Protein Size (# AA) |
255 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
4617 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Myogenic factor 5 |
Alias Symbols |
EORVA, bHLHc2 |
Peptide Sequence |
Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Roy,K., et al., (2002) J.Biol.Chem.277(37),33818-33824 |
Description of Target |
MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program. |
Protein Interactions |
ELSPBP1; ID1; MDFI; ID2; ID3; MYF5; TCF3; CSNK2A2; CSNK2A1; CALM3; CALM1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MYF5 (ARP32134_P050) antibody |
Blocking Peptide |
For anti-MYF5 (ARP32134_P050) antibody is Catalog # AAP32134 (Previous Catalog # AAPP03076) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MYF5 |
Uniprot ID |
P13349 |
Protein Name |
Myogenic factor 5 |
Publications |
Yang, Z. et al. Mononuclear cells from dedifferentiation of mouse myotubes display remarkable regenerative capability. Stem Cells 32, 2492-501 (2014). 24916688 |
Protein Accession # |
NP_005584 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005593 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
MYF5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
Image 1 | Mouse heart, mouse skeletal muscle
| Lanes: 1: Mouse heart lysate, 2: Mouse skeletal muscle lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:10000 Gene Name: MYF5 Submitted by: Anonymous
|
|
Image 2 | Human Jurkat
| WB Suggested Anti-MYF5 Antibody Titration: 1 ug/ml Positive Control: Human Jurkat Cell |
|